DPCstruct | MC17029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Standard deviation of domain lengths | 15.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.26 |
| Pfam Score | 82.16 |
| Assigned Pfam label(s) | PF20512- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A176VKC0 | 449-564 | RKLSSKEELALLLERQYPDDVGVFASFFLNYIKLVPGEAVYLAANVPHAYISGECIECMATSDNVVRAGLTPKFRDTETLCSMLTYE… |
| A0A0C2D051 | 2-123 | YEDFPGDVGIFSPLILNHMILKPGECCYYAAEELHAYLSGECVECVGCSNNTIRAAMTPKFIDREALCEVLNYRMTSPEYYLVPAIP… |
| A0A7S4P7Y4 | 10-144 | None |
| A0A1V9YWP1 | 206-323 | None |
| A0A2A6C1Y8 | 240-383 | None |
| A0A0V0QG18 | 132-281 | None |
| A0A4Y7JE65 | 388-505 | None |
| A0A0D8XK64 | 143-260 | None |
| A0A0N5CTX5 | 1-102 | None |
| W5SIU3 | 39-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.