DPCstruct | MC17022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0TNZ7 | 34-117 | TVPVRNYVDEHIGIDYSLLRDPAVSTDTLDLDFKGMFFPRTREDQELENHAVEPVIKETERMVYVAFSEYFFDSAMHAYFQAGV |
| A0A0C2C9X5 | 35-111 | LIDNFVKGMYIDNKHIEDPIVTNEYFETHQKGEIRYNSNNEPTPFYPKPMYTDGESDRMLYFYGSDFLFNSLLYHAY |
| A0A0N4WJJ3 | 12-88 | None |
| A0A498NXA7 | 127-218 | None |
| A0A183F7R1 | 6-108 | None |
| S9XQI5 | 171-269 | None |
| A0A0R3RM52 | 217-316 | None |
| A0A4W3J5A4 | 39-129 | None |
| A0A0B1SWE6 | 26-115 | None |
| A0A4U5PK19 | 44-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.