DPCstruct | MC1702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 161 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0E7J3 | 1314-1476 | EILKNSKIEFASILEKLCQGEELENEEQTAEGKKIFKELLKKIGSYSDTSIDIRFNNDCYYPGLKFGEEDDIESHKDLLADACEYLA… |
| A0A2A2J5U4 | 387-564 | MTFIKTAATHVKEKGQSLPAEKQNTLENEMARIFVELSEGHEIDSKFPLIKEALTKAAEAVHSLRPDTLDIRFNPDCYSTVLRHAPT… |
| A0A816ND09 | 818-984 | None |
| A0A817BIN9 | 347-514 | None |
| A0A7T8GSL7 | 26-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.