DPCstruct | MC17017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 223 ± 41 aa |
| Standard deviation of domain lengths | 41.38 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.76 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0023- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2BRW9 | 11-248 | NIQYLPLKLVDPVPSDIAISRSQIPKNIEQLAREIGVLPDELDPYGKKKAKVSLDVLKRLQHVKDGKYIVVAGITPTPLGEGKSTTT… |
| A0A2J6WKR4 | 160-399 | KTNKMKPITEIGKMIGIEPDQLIPYGKYMAKIPHQLIKDFENKKNGKFIIVTAITPTPAGEGKTTTSIGLSLGLNRIGKKAIVTLRE… |
| A0A5A9NF52 | 637-909 | None |
| A0A0D8XA69 | 101-273 | None |
| A0A6G0XHM6 | 19-296 | None |
| A0A1D2NA88 | 434-704 | None |
| H8MUY0 | 1-160 | None |
| A0A553MV03 | 325-597 | None |
| A0A6P8GIC8 | 364-534 | None |
| A0A402FFY9 | 1-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.