DPCstruct | MC17016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06388 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2BQS7 | 1-105 | MAKEGDPLFMTRATFDHQQLSQRTQCAGADFGVRPTNWQKRFLVLTKLYHSQAEIPEFVGSGTMNRMHDRMRIVLTFAAICGFFVLF… |
| A0A2A2JMP0 | 61-192 | RCTPSLFCGRSYSSLDPLEYKMAQKKQEALERANQATKLEHDQMGQTKRIVGAASHESGQVPTKWQRRFLIWTRLYNSQREIPEFVA… |
| A0A0N4WDZ8 | 41-148 | None |
| A0A1I7W7F1 | 36-139 | None |
| A0A0N4Z1S7 | 26-152 | None |
| A0A4U5NFH1 | 24-125 | None |
| K7H831 | 7-120 | None |
| A0A6G0V3M6 | 31-146 | None |
| A0A0N4U2W7 | 298-399 | None |
| A0A3P7LV75 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.