DPCstruct | MC17015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 158 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.67 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0366- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PP57 | 13-183 | LDAFSEPHASIYTFGCCMALTDLSADGDYKLIIADLGTGATSIKLKVYKGTSLMTELTLLDVPTGIVTFHMDLNEPHVPAIGVASGP… |
| A0A0C2BPU2 | 1-166 | MSALADDQAGLFTFFNCACLSDMYGDGDTKLVAAHVGSSKFNMRLKVYKGVTVVGESALADMPTAVVSFYNEKITLPAIGVASGSYI… |
| A0A024GAQ7 | 681-804 | None |
| A0A183RAK4 | 2-160 | None |
| A0A1I7WKB2 | 17-157 | None |
| A0A7R9QB23 | 3-146 | None |
| V6M5Q1 | 14-146 | None |
| A0A0B1TKU8 | 1-146 | None |
| A0A2P4UWT7 | 302-450 | None |
| A0A812BW15 | 13-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.