DPCstruct | MC17014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0063- CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3QG83 | 5-82 | GCYRRPYNTSQLGHEVLLADGSHQFRIMVVTDLDKSSKHPTEENQWQSFIEFGILTVNKDYTEASLQWNSNEQISLYS |
| A0A0C2BKL7 | 21-104 | DANIIWPCVECSHIAPRNITIEHHDNGSVTYQLLAITDMDREAKVDSKNWTWRAVTRRRRLTLSADKKNVSVEWMKDYDKNITS |
| A0A0N4Y0V5 | 463-544 | None |
| W2SN84 | 25-104 | None |
| A0A3P7EHT1 | 37-106 | None |
| A0A368GB00 | 9-85 | None |
| A0A183HIK4 | 66-144 | None |
| A0A1I7XFY2 | 147-230 | None |
| A0A6G0V042 | 42-124 | None |
| A0A183FVQ3 | 31-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.