DPCstruct | MC17010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 198 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5ZDG6 | 287-489 | LASVTAAPAFAAGAGSPNLALSLLALQMTLVFFAVAGLRAVIEVPAELRSNWVFRACWTGDLRRYLAGVRRAALTGVVLPLLALLLP… |
| A0A7V9BHK2 | 1-206 | PMAVRLGWAAFDAPRGSLLVGPLIFAALIQTGMRSLFAIPVEIRANWSFRLREPLRLDEAVAGAAAALMICGVVPPVLVAFTSAAWL… |
| A0A2V9CCD5 | 70-243 | None |
| Q01UT4 | 747-941 | None |
| A0A2N9L3B7 | 1-211 | None |
| A0A2V8HQT8 | 182-386 | None |
| A0A2V8CSI0 | 115-302 | None |
| A0A2U3KJK5 | 296-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.