DPCstruct | MC1701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 184 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 88.64 |
| Assigned Pfam label(s) | PF06535- CL0741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9EQL5 | 2-182 | CEGCRLEQCTREYDMAREEQGIADIGPTPESCRLARAYQKCVGSTSKSCRGDINFHFVVSMLERLITRHDCVNLLHKPPKGGNGSVT… |
| A0A158PAJ0 | 2-148 | VLSAEMALSTYLHCLNDTTLACRGNLQFYTNLFAMRKQFREFNCAFYKPRLATNRCNFLPKSPLSRMRMCSLFGDPHLQRFDGTMQS… |
| A0A4U1FJV3 | 245-449 | None |
| A0A556TPZ3 | 366-541 | None |
| A0A553NA32 | 206-430 | None |
| A0A6V7TLU2 | 32-228 | None |
| A0A218V5B3 | 54-278 | None |
| T1EJ00 | 3-153 | None |
| A0A5N5TGR9 | 19-187 | None |
| A0A151P0L2 | 472-657 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.