DPCstruct | MC17009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 27.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3Z108 | 59-198 | AQNQILAEIKQATSKFHKIESAMETGYELGSHCVSHSEWGAMGYHYVNSDEVDGQMNHLIPEALVYEPMQNGNLKLVAVEYIIMADL… |
| A0A7V9AVW7 | 7-156 | AAAVVASQSVFVEAARAGTARYADQSVAIADGYRRIGRDFPAMGEHWIRISLVFDGKVDPSRPEVLNYGVIDGTPRLLGVGYAVPLL… |
| A0A554V2H6 | 54-269 | None |
| A0A7W1KXG1 | 23-129 | None |
| A0A7W0S611 | 31-230 | None |
| X5P611 | 14-115 | None |
| A0A2E0RVK0 | 286-477 | None |
| A0A6J4KLW4 | 39-190 | None |
| A0A7W0PHJ2 | 2-123 | None |
| A0A7Y3PIY6 | 273-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.