DPCstruct | MC17006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 70 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 49.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3P0P9 | 6-77 | DGKNIPDNRHNVSIRFMDFVRDNSHQQVFEDDLFTIRYFQKGSGHITFKRLDLVEKMNDIVAKHFPGMLPAK |
| A0A735K5V5 | 6-79 | DGKTIPDNRHDVTIRLMDFIRDNPHQQVFEDDLFSMHYFQKGSGHITFKRLDLVEKMNDIVVKHYPGALPAKIN |
| A0A2A2GY56 | 39-122 | None |
| A0A5Q2VBW2 | 11-54 | None |
| A0A5U0W6C3 | 359-430 | None |
| A0A829IKZ3 | 18-88 | None |
| A0A6H1PXN1 | 7-100 | None |
| E0LWK2 | 4-55 | None |
| E0LU30 | 108-183 | None |
| A0A362XI91 | 178-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.