DPCstruct | MC17004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 468 ± 58 aa |
| Standard deviation of domain lengths | 57.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225X7F4 | 1-317 | MPNIKKTVSALVSAFNVNNYARRIIDTNFSVQRRDKRDCLIVSFDKGMDDYQCKRYLSDIKRSIICEFYDVEKGNDKEILNTAELIF… |
| M9WUU1 | 1-411 | MTSLDFVKELVNAFNVSNYGSKVNTNFVVEGDNIVVKFNCGRRSAKRYLSQMARDLVREYYSDEFVACHVFDLESFPFHFDKKWLKY… |
| A0A1A9VJW7 | 63-503 | None |
| A0A060Q1L1 | 1-497 | None |
| Q5GRL5 | 20-577 | None |
| Q0RAH9 | 1-488 | None |
| A0A8A5WA08 | 1-507 | None |
| A0A7G5CCF5 | 1-462 | None |
| A0A7G5CAK4 | 1-503 | None |
| A0A6I5SX41 | 1-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.