DPCstruct | MC1700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 152 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7KTL9 | 13-167 | KEWNKAKKVAKEFEPRYEPYVDEKYKEYLKGTGKAEDLVGVDVVAALDMYAENGQWEKCVQTAAGMNNFKVLHKYVALYATTLIKEG… |
| A0A7R9EP13 | 1-136 | MDTSENLKIIYEAYVDERYKESLKRQGRADQLADLDIIAGLDLLAEQNQWSRCLETASQHSQQVLHKYVALRSTQLIQEGFTLEALS… |
| A0A654H4R0 | 230-398 | None |
| A0A6L2PMY4 | 335-488 | None |
| A0A183IQK4 | 2-125 | None |
| Q9UG01 | 1372-1534 | None |
| A0A7J8FHH7 | 426-588 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.