DPCstruct | MC170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 169 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2E7R3 | 19-190 | ILYSVAKKAAEYETHLEVPTARSLVMTTARETVKEAYLSTGRPDLYSENSIYYVTDEQFGYVAYADGYIVREKPATCIYMGAFYAES… |
| A0A7C3E9H2 | 213-371 | PPLFTLALAAARDAYESEGAPEAFNRDDVMFLTGDQFAYASGVVGILNREKVSSVFYFGDFYAESLILAENGQQVGAIQVAGTPQIM… |
| A0A3D2RZ05 | 493-649 | None |
| A0A1W9ISG6 | 208-376 | None |
| A0A7V5ARX8 | 714-890 | None |
| A0A7V9AR08 | 170-338 | None |
| A0A832FX63 | 310-483 | None |
| A0A7X8A5I0 | 7-174 | None |
| A0A4Q3W3C9 | 87-254 | None |
| A0A7C2KUC6 | 302-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.