DPCstruct | MC17
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 124 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6HD02 | 2-122 | KTVFWRTLVIIFIILAIIGAILPGMPTTVFLILAAWASSKGWPQMDAWLLNHPKYGPTLKNWRENGTVPRKAKWLASIMMLMSAIIM… |
| I5C8Q5 | 242-362 | FEHAKRTMLLIMGLVMLLLAVIGAFLPVMPTTIFLILAGWFFARSSPALERKLLEHPKLGPVLRNWRDHGVMSRRAKLLAAGGIAFG… |
| R5YJR5 | 2-120 | None |
| A0A136NSC6 | 53-184 | None |
| A0A439KRT8 | 148-268 | None |
| A3JYU0 | 3-118 | None |
| A0A3E2W4D1 | 103-225 | None |
| A0A6N7JQ47 | 87-215 | None |
| A0A381NE11 | 13-148 | None |
| A0A3N5NT18 | 2-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.