DPCstruct | MC16999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 194 ± 41 aa |
| Standard deviation of domain lengths | 41.20 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1L820 | 207-370 | PKAFRDQFDEIAAKVFIPTTQTVRLTGTEATTAKVQKIAKVHDEINQFLMEFIDHSNTTADYVLRDRSFLESVLDIDFKDTTQTGNF… |
| A0A2R5L440 | 33-199 | TLPSAVFEQYRRLRKPLTTYSQGPDRMQIAEGHLSRADIETVVNTYAVITKFLSAFIDHSVKELDYTVKDRALVEKLLDIELHDGYD… |
| K1PVM1 | 245-357 | None |
| A0A7S3AE85 | 29-169 | None |
| A0A2A6B719 | 892-1104 | None |
| A0A7S4FCH2 | 124-325 | None |
| A0A815KDE6 | 64-264 | None |
| A0A6J0VBK8 | 245-435 | None |
| A0A814P900 | 14-145 | None |
| A0A5A8CU97 | 599-851 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.