DPCstruct | MC16998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212SZS3 | 1-116 | MPVCDFVVWAARCGHSRDLLVPHRPKADLEELDEDSHWELLQQCLTDTALPLEVRTAGAVLLLFGQHVTRIAALPADALTTVDGHTV… |
| A0A3N1B2C9 | 215-317 | IRGFFTWATRTSAMPRHLVLTPVKFAIGTAVTQQQRLTLLRHYLTNEALPLRERTAACLMLLYGQPISRIHRLHNNDLDLNSGTPTI… |
| A0A5P2C716 | 168-266 | None |
| A0A4Q1QST6 | 107-206 | None |
| A0A1H8KHQ3 | 1-100 | None |
| A0A8B4DPR9 | 272-373 | None |
| A0A6G3SFF1 | 15-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.