DPCstruct | MC16996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212SW01 | 77-172 | ARRDGYLAAMAAAEHILSTTPVLPVDVDVRLAEWNNGPTLVIGFHKDPDQVRAFASHFGTEVAELPHGEGRVRIETTGTMAGVRFEA… |
| A0A3M0HTP5 | 23-133 | LATIEAFEAGAFRTGYVARRLLAELPGLPLREISPLATAYADRDATTAQLELNTGAVEGVRAWGDVLGAEVEVSFHDERRSRRVYEL… |
| A0A3N6GQ42 | 1-108 | None |
| A0A1I3LKV0 | 1-110 | None |
| A0A1H7QMI7 | 53-157 | None |
| A0A5N0UTY5 | 1-133 | None |
| A0A0N0NCY9 | 65-161 | None |
| A0A1H9U5V1 | 1-109 | None |
| A0A2G6ZAT8 | 6-148 | None |
| A0A7W2HJD9 | 4-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.