DPCstruct | MC16995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 5 aa |
| Standard deviation of domain lengths | 4.56 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 37.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2XCA1 | 510-624 | RVITEAKRKVLELHHDGYVQKPQRDDILVLGRTALGALYSGVEAFGISNYASEHDMLIGRKLAFVMSGGDLTQPTKVTEQYLLNLER… |
| A0A2E4EUM7 | 1-101 | MAKDYTPPEPRELRLPGPSGEAAMTLVLNDFHRAGKATEHDVTVGKKLAHVLAGGKVDPTDTLTEDKVLGLERTAIVSLLRTSPTLD… |
| A0A097ER31 | 779-896 | None |
| A0A2D5G0N8 | 138-254 | None |
| A0A7V5YSL7 | 44-159 | None |
| A0A7Y2C8V7 | 53-171 | None |
| A0A2W6SN34 | 573-690 | None |
| A0A7Z9S5V6 | 416-532 | None |
| A0A3C1L0M8 | 73-188 | None |
| A0A2N9N1M7 | 925-1043 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.