DPCstruct | MC16993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 166 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N1YGB7 | 1-164 | MLKDYIQLCWFKGEPHDLPVDRKFLWINISLYLLFGLFIQANISDPIEAFLQVFLEILITLIFMSVIVLKKDEGFYNFERFLTAILV… |
| A0A2D6KBB1 | 5-168 | LHTLLAIALFRAKPQDLPSSNQLLVVTTFLAILTYALTDTLHDQIGLIMATAIAQVVLFGAAIYFALRIKNVAERWPQTITALYGCG… |
| A0A1Q2SMR1 | 7-173 | None |
| A0A2D8XX25 | 1-166 | None |
| A0A1S9D3F2 | 9-185 | None |
| A0A2G6EJI5 | 1-167 | None |
| Q2VNL2 | 31-204 | None |
| A0A2E3CU24 | 51-220 | None |
| A0A7C1XT57 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.