DPCstruct | MC16991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 46.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4WUE4 | 79-176 | MAWGIKRISNDDLRQRFVDATVEQARVLGVTLPDPGLTWNKARGHYDFSPLDWSEFKRVLDGHGPCNRERLATRKRAHEEGEWVREA… |
| A0A1Y3Q3X7 | 19-119 | KWRIKCDTNDDLREAWLDKIVPLLSSLGYTIHDPLLKKDEHTGRWNYTEVDWEEVKRVINGGGPYSAYWKEKVKKSYEETAWIRDVV… |
| A0A7C4I998 | 221-318 | None |
| A0A538AHA4 | 61-150 | None |
| A0A0K2RN87 | 3-92 | None |
| A0A7W0PTM6 | 2-83 | None |
| A0A822E4D5 | 371-470 | None |
| A0A7K2CPF0 | 10-99 | None |
| S7X115 | 217-314 | None |
| A0A7W0FSI4 | 141-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.