DPCstruct | MC16990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Standard deviation of domain lengths | 15.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2I4H0 | 9-150 | GIKKKEIDYCAIYSRVFTKVTNDRTQQIAETGACDKDTIRKIVYYGIKFVNQLKDINSYEGLIAKFQLISWIKEVIGELTPREFMTI… |
| A0A1Y3Q3G1 | 10-161 | KKNMPDYFTFYNRIYNDALRRASEKLDSSGELDAEDLKRIVFSGVKMIAHLDDELDYGIATLSIHLIHFITDCASKLTPMEFQTIFP… |
| A0A6N7WN47 | 164-326 | None |
| A0A173WAA4 | 9-188 | None |
| D3ANR5 | 203-371 | None |
| A0A4Z0QMH3 | 4-154 | None |
| A0A5R8LDG4 | 1-174 | None |
| F2JQ53 | 2-154 | None |
| A0A1I4I7Z6 | 6-172 | None |
| A0A7G8X113 | 12-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.