DPCstruct | MC1699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 26.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03788 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1W1N0 | 1-108 | MIATFASLLVFQALGEGLSYALSLPIPGPVIGMVLLLAYLMIRPAMVDKLAPTAMGLLRHLSLLFVPAGVGIMVHARLIAAEWLPIS… |
| A0A3A6RM84 | 8-142 | SLHSVAQSRKLAAWASNFAQVILISLIWLVAGKIAITLKIPLSGGVLGLLILVVLLMTKVVHPAYLENGAEILLTNMMLYFIPLVVS… |
| A0A2K4C3Y5 | 19-142 | None |
| A0A8B5WUJ8 | 2-111 | None |
| A0A0R1H6P9 | 8-148 | None |
| A0A2N0F415 | 66-204 | None |
| A0A369LJN5 | 11-150 | None |
| A0A3E5GNA9 | 2-116 | None |
| A0A347WI76 | 30-158 | None |
| A0A0L6W0R2 | 32-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.