DPCstruct | MC16986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04442 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DXF8 | 1-89 | MSKVKDRLITIKFNADRGASMRWKFRPQQTEVKVAPGETALAFYTAENPTDNPVTGISTYNVIPFEAGQYFNKIQCFCFEEQLLNPH… |
| A0A7Y1SH56 | 1-86 | RLERGVADADRGGHAVSDRIVTVQFDGSVNSKLPWEFRPHVVSMKVRPGEQYETTYYARNTSDAPIVGSASPSVAPARASGYFNKT |
| A0A484KJW5 | 104-172 | None |
| A0A6I9MVU7 | 109-184 | None |
| A0A5K3FAN5 | 78-153 | None |
| A0A2I0BCZ9 | 153-220 | None |
| A0A5N6MLZ9 | 46-114 | None |
| W0BIY8 | 43-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.