DPCstruct | MC16985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 326 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4G599 | 49-385 | TRVADDERDRSRDRRIFDRLTVVARVGDPPLDPRLRTELNRIEAAYPEWAAPEGERVMFSSWSEFSVGPDTDYGLDDLAKLPQDELV… |
| A0A3B1AY22 | 1-365 | MYRNDLTDKKWQERYDRDIWHLLVKLNNFGRNIPDNAQSILDSIQKKHESLVLKEGVRDEFTHWSESHIGHDLDITVDELFDLAIPE… |
| A0A090RXA1 | 595-919 | None |
| A0A562NV05 | 7-317 | None |
| A0A4D7CC65 | 2-289 | None |
| A0A0D0Q6J2 | 580-889 | None |
| C8ND82 | 748-1087 | None |
| A0A353UZN3 | 178-496 | None |
| K1JI64 | 1-318 | None |
| A0A0F2RDE2 | 266-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.