DPCstruct | MC16984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9HKY7 | 158-260 | IHDHVAQGFARYSTDERWHVPHFEKMLYDQAQLAVAYSAAYLATKDEFYADIVRDILLYVSRDLSDKSGGFYSAEDADSYPSHDAKS… |
| E2B587 | 273-379 | IHDHVGQGFSRYSVDGEWHVPHFEKMLYDQAQIIQAYADAYVITKDSFYSDIVDDIAKYVERDLRHKEGGFYSAEDADSLPESKSSA… |
| A0A5N4D5N7 | 902-1003 | None |
| A0A451AGY9 | 1-79 | None |
| A0A6G3VRR7 | 1-89 | None |
| A0A017TIA1 | 589-695 | None |
| S4RUA8 | 155-257 | None |
| A0A0D8XUJ6 | 193-303 | None |
| A0A3P6R406 | 151-260 | None |
| A0A7J5B9H3 | 125-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.