DPCstruct | MC16979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 701 |
|---|---|
| Mean domain length (aa) | 88 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.62 |
| Pfam Score | 90.47 |
| Assigned Pfam label(s) | PF20417- PF06365- PF20660- PF21166- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3RUN2 | 2-71 | SVITQDGRVIVGTLKGFDQTVNLILNDSHERVYSSGAGVEQVALGLYVIRGDNIAVIGEIDEDVDSSIDL |
| A0A7S4GKF5 | 7-96 | RARMTSYLNEQLRVSISDGRVFIGALICFDNHKNIILKDCSEFAKKTIKLKSGDKERELTRYLGLVLIPGQHIVRCQVYVRPPIITE… |
| A0A287D6J1 | 2-73 | None |
| A0A4S3ZSC0 | 19-143 | None |
| A0A6S7NA56 | 209-324 | None |
| A0A6I8W9A0 | 7-98 | None |
| A0A1R3HQA5 | 365-461 | None |
| A0A4U0XRA1 | 252-333 | None |
| A0A0S6W551 | 20-112 | None |
| A0A7S4PFG5 | 26-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.