DPCstruct | MC16976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5Q0K2 | 31-139 | YYYEQVNRHAIVVKPKQLLLNWINALYPDMAEDGSETTVYLVKERNNFEDTEKWLKRNFNMIFENELNGRHTDESDWPQKRTHKLFT… |
| A0A5Q4EEC9 | 6-104 | EYTALVLVRRESFYEWLQMAVHQSGEESESTFEGDYGTYLVKGVITPEDVYAFLQSGYREIFENELSQWYDRAFWPHELTPELFLEF… |
| A0A2N5CJZ8 | 6-121 | None |
| A0A7T1HY51 | 1-113 | None |
| A0A517T239 | 36-146 | None |
| A0A1Q7JHB3 | 4-114 | None |
| A0A3D0R7K8 | 1-99 | None |
| A0A3D3UPP5 | 1-83 | None |
| A0A368N096 | 86-208 | None |
| D6HB02 | 97-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.