DPCstruct | MC16975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5S0B0 | 4-128 | INKGNTIHVSASSIQDQRVTIKWSQSLKSRSEDYYVASYNVPGSDAQGAIFVQASKLDEFKNKNKGDSITVDVDGSFQYGQDKAQTR… |
| A0A2N6BK40 | 29-138 | VRLVRAGDQIVFDPQSLKQPENTISVAWRQRLRSRKANYAHTAAAIKTAGVNEVLSIFVEKARLNDFLAKCATGQNGLCTLKAGPEF… |
| A0A4S8KZ41 | 3-105 | None |
| A0A6A6ZK90 | 19-129 | None |
| A0A177T6E8 | 161-269 | None |
| X6MC18 | 14-132 | None |
| A0A074RS95 | 6-114 | None |
| A0A3N4HUI7 | 5-108 | None |
| A0A2N6BK53 | 35-148 | None |
| A0A6A6XDP7 | 5-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.