DPCstruct | MC16969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A132MTW8 | 1-55 | MELSAAELRLVVSPRRSFYLFRCPRCEQAVRKPAGPRIIELLTDGGVLSVRVHAS |
| A0A1J7BY43 | 1-69 | MTVFRVGCPHCGGRAHLESGEVRLARTRSRTFYAFTCPDCGEPVRKPAGERIVELLTGNGVAEIGLAPR |
| A0A499VKH8 | 51-119 | None |
| A0A3N5LMY6 | 133-203 | None |
| A0A2S2G3P2 | 31-102 | None |
| A0A7H9A0E6 | 30-99 | None |
| A0A1C4NAA0 | 143-211 | None |
| A0A1F2W729 | 1-54 | None |
| A0A420XJP8 | 3-69 | None |
| A0A7K3BJK3 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.