DPCstruct | MC16967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 4.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2BG15 | 1-86 | MESAPKDGRLVRLLVSFEENAIDDGDEPFATIGQNNFQNDQVDRWQFVGWNWTHDEFTDGQGTPLGWLPMLDEQSAAARDVLAERQ |
| A0A4Y9RZW4 | 3-94 | TTSTPEFRPISTAARNGTMLRLWVRYPKDGSWTPLEDARESWTIGFNNSDNTEEDRWQVVGWSWSHDLLVEASTDVEVLGWLPFHGE… |
| A0A7X5Y3P4 | 101-198 | None |
| A0A3C0GNB1 | 154-240 | None |
| J8VU18 | 58-148 | None |
| A0A7G5DTT2 | 1-96 | None |
| A0A6G8YLU1 | 218-305 | None |
| A0A1H0N1I4 | 57-150 | None |
| A0A839DMB9 | 169-249 | None |
| A0A4R1V736 | 231-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.