DPCstruct | MC16961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 735 ± 87 aa |
| Standard deviation of domain lengths | 87.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.54 |
| Pfam Score | 86.44 |
| Assigned Pfam label(s) | CL0007- PF20776- PF20778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4KNC4 | 2-616 | EISLYRPDTLRVSRERYNQMVEELDNAFLRSQLWEYYSEFVSRTPEKVIIPLRKTAKKSQVLNTILRNLWDIEVTDEIAEREDVLIT… |
| A0A5N7E794 | 226-905 | ISWSNEVHDLQSTRAKEGEHFPSTGAATKSTSANRLSPSFERRPKSSSGNQFRNDENADDILDDDLITERIESFRAPYRPGDKLSPA… |
| A0A423XCT1 | 70-996 | None |
| A0A086T078 | 128-868 | None |
| W6MHN9 | 55-804 | None |
| A0A178APT5 | 1-702 | None |
| Q70GH5 | 32-923 | None |
| S0EBT2 | 125-884 | None |
| A0A3N4H820 | 1-703 | None |
| A0A397I128 | 509-1232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.