DPCstruct | MC1696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 142 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8RPQ2 | 1-140 | MRNTFNLAVVLLLGGCRFVLSQNGYNGVTIDLDGTLNCPPDANRRSYCAGDSNSTEFIVHCDNGNARLGACSLDLVGVQPAGVKLGA… |
| A0A1B8CVK1 | 3-131 | LSTALLISASAALTSATGPDYDPATNKWTGRVPDVVYCAGDSLKTNIIIRCTGLVGQPGNCNDNLAGQPPLSVQPTLCYAPELHKAA… |
| A0A367L1R1 | 77-224 | None |
| A0A7J6J9N3 | 1-142 | None |
| R1FX47 | 1-128 | None |
| A0A1L9TFL8 | 59-209 | None |
| A0A218YWU9 | 7-142 | None |
| A0A317WY84 | 1-160 | None |
| A0A2I2FJ98 | 3-155 | None |
| A0A1L9S6S4 | 15-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.