DPCstruct | MC16959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9223 |
|---|---|
| Mean domain length (aa) | 271 ± 60 aa |
| Standard deviation of domain lengths | 59.62 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 12.67 |
| Pfam Score | 82.67 |
| Assigned Pfam label(s) | PF14479- PF14484- CL0219- CL0010- CL0590 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4PR51 | 136-356 | DAVQSLKQYREVLASVFDNDRHRAKLCLADFLDLDVGRHWQKSDSCLIMLSGRNENGVSSPMSWLSPMAVDMILSLLSEKSRVLFAM… |
| E6Q2R4 | 20-317 | AGTVPPALVGRDADLEAIEDAIAQVAGGEPPQVALFVGERGMGKTVLLRRCEQMAREAGGIVLRGEMAPHADLQRAFAPGVQRAQED… |
| A0A7Y3JJC2 | 4-231 | None |
| A0A6P8HJF2 | 91-432 | None |
| A0A2V9TME3 | 53-284 | None |
| A0A453DNV9 | 31-299 | None |
| A0A453DYU8 | 21-330 | None |
| A0A352AN12 | 468-805 | None |
| A0A2G8LJ88 | 3-284 | None |
| A0A2G8L1K1 | 172-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.