DPCstruct | MC16956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 206 |
|---|---|
| Mean domain length (aa) | 251 ± 51 aa |
| Standard deviation of domain lengths | 50.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 12.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8TFR8 | 47-314 | PRVSPEFQPEVSQLASTGLKLKEAVEASLDGAAHHLAAIFQREKPKAPNEAFELRILEGDGQTAKTIFRRADFFFSFALTGQPNQLN… |
| A0A355E859 | 27-301 | SRPRSANWSPASLEESRRLGGQGYAIAEHASVQVPEGRLAVVVYRKSGGAPRLGVSLVTDRGQKLLHMKIGSSFDIKLASIHKSGSI… |
| A0A1G8B9E9 | 4-230 | None |
| A0A3M1DM98 | 13-334 | None |
| A0A7C9IPL8 | 21-259 | None |
| A0A847ZJZ1 | 20-343 | None |
| A0A2N2MKJ4 | 356-667 | None |
| A0A357D3I2 | 502-664 | None |
| A0A7W0WA33 | 407-788 | None |
| A0A7C3U2W9 | 316-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.