DPCstruct | MC16948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367Y603 | 1-66 | MRPNCECCDRDLAVSDPDVYICSFECTWCGECARKRLSMTCPNCSGNLTPRPIRPASTLADHPPSN |
| A0A2Z3HQA0 | 4-68 | MKSACERCAAALPADRTGAFICSFECTFCEACAGGELAGACPNCSGVLLPRPPRAAALLERFPPE |
| A0A2V7DJI3 | 33-92 | None |
| A0A2A5DIC3 | 2-62 | None |
| A0A6J6P7D6 | 2-59 | None |
| A0A7Z0SHB5 | 2-65 | None |
| K5DNK3 | 2-57 | None |
| A0A2G6CIP9 | 2-75 | None |
| A0A369KSP2 | 44-95 | None |
| A0A7W7JNW6 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.