DPCstruct | MC16946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 202 |
|---|---|
| Mean domain length (aa) | 280 ± 58 aa |
| Standard deviation of domain lengths | 57.70 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.39 |
| Pfam Score | 95.35 |
| Assigned Pfam label(s) | CL0123- PF20231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2D1Q6 | 11-234 | LKVLGKHSKTLIADHARDPEKNGFIVFDNVQNYLRVRDHRFGRANTMNIGLAGTYCELPGVEAGALSFSEKKAQLALNKRASLTTER… |
| A0A1E3JXC0 | 31-319 | RRAARMSMAITFIISVVLYTANTSLNVFQILAGLFLSSTSTSESTIDAPNRLGVCITYTSIWRAWMSLDAEADSVAKKLFQLGKDGV… |
| A0A2N0QZ53 | 25-223 | None |
| A0A6S7FBT3 | 112-450 | None |
| A0A2N0QZS5 | 2-230 | None |
| A0A2N0QYW4 | 30-343 | None |
| A0A4V4HAN8 | 106-426 | None |
| A0A835CQ56 | 234-497 | None |
| A0A2B4SC88 | 5-246 | None |
| A0A7M5X2C1 | 107-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.