DPCstruct | MC16944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Standard deviation of domain lengths | 17.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10025 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833G476 | 112-242 | DQAVQQAHIWINDVDDRLGWGNKPRAYRLLRAVLHALRDHLPVNEAADLGAQLPTLIRGVYYEQWRPAVMPVKERHLEAFLAEIDRA… |
| A0A3D9V750 | 16-143 | YDWLTTVAQHLGTQDCDYAFRVVRAWLHAVRDRLTVEGAAHFAAQLPEILRGVFYDGWTPSRVPVKTDVEDFLRTFCQEAMISVEDA… |
| A0A2A6K631 | 3-130 | None |
| A0A6J4K6J6 | 4-138 | None |
| A0A3M1EED7 | 5-129 | None |
| A0A7W7H2L9 | 54-219 | None |
| A0A243RFS9 | 259-402 | None |
| A0A1Z4V3U0 | 40-166 | None |
| Q6MPD4 | 204-348 | None |
| M0DPE0 | 14-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.