DPCstruct | MC16941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653LXV7 | 2-100 | KKRIYTTLTIFVIIIIGGWFLYVDSKKEQLEEMVYEHLVEDKQVPKNEIVSVTAFNANLPKDKNYLVSVKLMNDPNTYYYYRVSNGS… |
| A0A3L7JXY2 | 1-134 | MEGIMKKKLLSLLLIVFCILFGGFGILYDGLYGNPFRDYLMKNDTMRYLNDIGYTKNDLLSVRTNYSMKINSDKVKGTLAKVTFKDE… |
| I0JKM0 | 78-194 | None |
| A0A177L5E3 | 1-116 | None |
| A0A3A6IJ01 | 1-103 | None |
| A0A0J8D9P1 | 1-100 | None |
| A0A5D0CX79 | 1-114 | None |
| A0A0M0LLC0 | 1-128 | None |
| A0A6B9YIA6 | 1-114 | None |
| A0A239MKA1 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.