DPCstruct | MC1694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849FVV5 | 95-158 | ILVKMSKPGQDRRVDLPAIGPATLRLAALCGLEGVVIEAGGVMVLERDEVTRLADELGLFLWVR |
| A0A2Z5ZFY0 | 3-63 | LLKPGQDKRADMPTIGPSTLRNASKAGLRGVAFEAANTLMTDRDGCIAEADKAGLFLIAID |
| C7DFG1 | 235-301 | None |
| A0A2E0F840 | 31-96 | None |
| A0A2V8IJA7 | 80-142 | None |
| A0A7C2KUV0 | 158-226 | None |
| A0A0A8K3Q9 | 198-263 | None |
| A0A2V7I7M7 | 345-413 | None |
| H1D6P8 | 42-107 | None |
| A0A836VKZ5 | 141-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.