DPCstruct | MC16939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 106 ± 22 aa |
| Standard deviation of domain lengths | 21.63 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8SDX0 | 26-135 | GNKPDRVGVLKTTDKYSVLQQIGTDGINYNITNDSLITIIKRFDKQYSLELIGASGDWCEFLIHKEPKNWLTFAKEIYKVCPDVVDQ… |
| A0A7Z1KC12 | 31-116 | LHQNPLPLYQSLIFKHWQDQYEITLLAVSDDTWIVQAGKCPETQEEALRLAKDHFIYCHYVLESYPTLGHYTDYLMKHDVWYFWWD |
| A0A3B0CTC7 | 32-136 | None |
| A0A5C7A593 | 225-329 | None |
| B9XHJ6 | 2-138 | None |
| A0A7J0D4D1 | 22-133 | None |
| B0MZA5 | 686-790 | None |
| A0A6G9GSM4 | 109-198 | None |
| A0A0K2WCL9 | 86-184 | None |
| D7DYJ5 | 4-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.