DPCstruct | MC16934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 210 ± 28 aa |
| Standard deviation of domain lengths | 27.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2U8W4 | 205-401 | TFSTMYDNIQAFAKTSASLSETDASLSSTLDRHLLRSLCPDLVAVLIKLLALENLIQFDVDKPLSSDERKEILNESAPADKKTFNEL… |
| A0A7S3G4L1 | 28-243 | SAGGEGGSSGSSKGMEGMEKHVLKTLGYVVFDSILMMFASDFELGKMEREAGVKRVDEDVREEMKYLLTNVNDKSISAFADAVDTFM… |
| A0A4D9BW41 | 548-748 | None |
| A0A0N5ACC8 | 278-453 | None |
| A0A1E1WQS8 | 189-382 | None |
| A0A438G1H8 | 625-809 | None |
| A0A6H5HJ37 | 45-239 | None |
| T1FQH7 | 642-878 | None |
| A0A0D2MD11 | 828-1052 | None |
| A0A1X2GQ17 | 444-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.