DPCstruct | MC16933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 95.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822CKE6 | 1-75 | LDFPFDQAIQEWISQGGEPWQLIESVDGFHISQYGHAITSDVIWSWLQSNKPHWLPPANPHNADIERVFKDQGGY |
| A0A7S3G036 | 1-98 | MVYQDLVSSSNKGANYTNFDLIYLTSPLLDILTDWDAEGKNPAELIEPVDGFHPGQIAQALEAKWMYEHLEEAYPEFLGEVNPHNDD… |
| X6MGJ8 | 1-115 | None |
| A0A818J9T7 | 127-237 | None |
| A0A2B4SMI2 | 154-265 | None |
| A0A226MH73 | 154-265 | None |
| A0A820HE26 | 1034-1125 | None |
| A0A7S3CVG2 | 58-173 | None |
| A0A812D115 | 84-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.