DPCstruct | MC16931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 22.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3DFR9 | 1-143 | WKGINMLNLQQEGLYEGQLAGNPKGALSKFQIWSLNAADDISDILSALNRTKRPDYLAMSASTVFASSHCSALIKVTPGLDEIYFGH… |
| A0A0C2C7D7 | 2-102 | IQLSGELFDLNKYLNKTPDPLEYPESGRCSGLVKLAPGNKDMFFSHVAMSSLSWMMRVLKLYKFAFDEKEVPGHTVTFSGYPGQLAS… |
| A0A183W939 | 2-112 | None |
| I0YMY4 | 29-193 | None |
| A0A812BAZ0 | 1-141 | None |
| A0A6G0Y135 | 121-297 | None |
| A0A0M3IVM4 | 76-212 | None |
| A0A183LHR7 | 21-178 | None |
| A0A813HIS4 | 4-169 | None |
| A0A1V9XI65 | 20-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.