DPCstruct | MC1693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6NLX8 | 11-84 | PSGHVSVVRRVENSRLVLVDHANWEPGRVTRRAPVEDVSPRNDWTRVRVWWSPLGGMGKTIYPTYGFIEPVALR |
| A0A2N3PRN7 | 74-158 | IVFSKTGILPHGHVAVVRHQADKRTIIVDHANWSPINGRRGQVEKAVKIIDVSKHNDWSRVRVWYEPTAEIGQTVYPVKGFVYPA |
| A0A545B2H4 | 77-149 | None |
| A0A257R316 | 110-194 | None |
| G2KPV3 | 103-191 | None |
| A0A257Q216 | 6-80 | None |
| A0A4Q5WJ07 | 9-83 | None |
| A0A2U1VXG1 | 61-150 | None |
| A0A4P7WDZ7 | 36-133 | None |
| A0A318N111 | 63-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.