DPCstruct | MC16928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 209 ± 37 aa |
| Standard deviation of domain lengths | 36.92 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7CZR0 | 24-213 | TLILQANEEWLDTALVNATDSWYLAREAETLPEHEAPVFSALVPDRSRDRNMACLMVGRDKDGYGDLAAMMGLPNTEFDKCVASYPG… |
| A0A0D1EKW1 | 21-225 | LNNLRFTLWHEAGHAVIDQMDVPIRGPEEAIADGFALMLAARLLGPDEMAQLLSDVAEQARRDAVDEVFDAWSPYMPGAQRVAWLIC… |
| A0A4Q2XZ02 | 102-325 | None |
| A0A1E4G419 | 278-497 | None |
| A0A1W2AU81 | 87-313 | None |
| A0A6J4ZHF2 | 232-479 | None |
| A0A7W0WZR5 | 157-405 | None |
| A0A1V2ARM9 | 28-262 | None |
| A0A0D2JHG8 | 21-225 | None |
| A0A024KDE1 | 273-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.