DPCstruct | MC16924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.87 |
| Pfam Score | 92.95 |
| Assigned Pfam label(s) | PF00557- CL0356 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0E3C8 | 312-375 | CFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISY |
| A0A819PVF7 | 1-67 | ECFTRVLKGFISLASCLFPPNTTGARLDSMARRALWDVGLDYRHGTGHGVGCCLNVHEGCFLFSIFN |
| A0A6A5L1T0 | 716-781 | None |
| A0A1S3XUZ9 | 228-291 | None |
| A0A5N5SY00 | 329-396 | None |
| A0A6H5H6W6 | 289-354 | None |
| A0A2H9TH65 | 429-486 | None |
| A0A226EMT1 | 996-1060 | None |
| A0A7S1T924 | 415-479 | None |
| A0A822XPZ3 | 74-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.