DPCstruct | MC16923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 150 ± 19 aa |
| Standard deviation of domain lengths | 19.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N8JZ27 | 76-229 | CERWMNCKSEFLKKYMLKVTNDLPSCPCSYPTEVAYSTTEIHDIISRKDFRWKDASGPKEKLEIYKPTARYCIRSSLTLESTTLAAQ… |
| A0A819P859 | 31-187 | HQEILHRGLSSCLLWYQSQPDPATLLAKTLKPPCSISPAFSETLPGGWSVDPGCDASKQPNTCDMHKGANGCYRSAISNTGPGDQAC… |
| A0A2R7VRA7 | 83-220 | None |
| A0A2E9IP97 | 87-245 | None |
| A0A7V6HG74 | 327-492 | None |
| A0A821K1W4 | 1-125 | None |
| A0A821IQ22 | 71-222 | None |
| A0A7H8PK49 | 141-273 | None |
| A0A498NG59 | 289-430 | None |
| A0A820SAX0 | 132-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.