DPCstruct | MC16921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 8.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819NG90 | 11-112 | KTSVLNRRTLDLLSAKCYFYYARIFELNNMLDTIRPFLHSRLRTATLRNDFEGTAVLINLLLRNYLHYNLYSQAQKLVLKSVFPDHA… |
| A0A5N6YEP6 | 285-404 | STSLIERLRTINRRTLDSLAARVYFYYSLFFEQIAPLPPSPAATVTTIRQPLLAALRTAVLRKDVDTQATVMTLLLRNYLSTSHISQ… |
| A0A0B1SKX5 | 160-273 | None |
| G3ILI6 | 3-104 | None |
| A0A1I7WUY0 | 65-167 | None |
| A0A2I0TJT7 | 322-436 | None |
| M1USQ7 | 279-394 | None |
| A0A7J6Z9F1 | 400-511 | None |
| A0A446SCF6 | 148-257 | None |
| A0A6A3D5F8 | 28-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.