DPCstruct | MC1692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.59 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF12418- CL0544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2KYP0 | 1-105 | NVGDLEFNLFEVLALEKALAGGDFGDLDPQSARDMLVQAAELAEGPVAEAFAETDRTPPSFDPATHVVTIPAAFKKSFRAWYDGDWF… |
| A0A7T4R5F7 | 1-107 | MSYQAPLREMQFVLYELLKGDEILPSLPGFEDATREIMDAMLTEGAKLAQNVIAPTNVPGDREGCVYDPVAKTVKTPTGFKEAYQQF… |
| A0A418X832 | 2-106 | None |
| A0A5K7YQ75 | 1-91 | None |
| A0A3E0PKY3 | 1-140 | None |
| A0A2A2K5R7 | 130-247 | None |
| A0A847Z996 | 1-114 | None |
| A0A6N0X332 | 1-98 | None |
| A0A1F2VC07 | 1-87 | None |
| A0A0E3BUE0 | 9-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.